| Class b: All beta proteins [48724] (180 folds) |
| Fold b.55: PH domain-like barrel [50728] (3 superfamilies) barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix |
Superfamily b.55.1: PH domain-like [50729] (14 families) ![]() |
| Family b.55.1.5: Third domain of FERM [50776] (8 proteins) |
| Protein Merlin [69294] (2 species) the neurofibromatosis 2 tumor suppressor protein |
| Species Human (Homo sapiens) [TaxId:9606] [69295] (1 PDB entry) |
| Domain d1h4rb2: 1h4r B:215-313 [65620] Other proteins in same PDB: d1h4ra1, d1h4ra3, d1h4rb1, d1h4rb3 complexed with so4 |
PDB Entry: 1h4r (more details), 1.8 Å
SCOPe Domain Sequences for d1h4rb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1h4rb2 b.55.1.5 (B:215-313) Merlin {Human (Homo sapiens) [TaxId: 9606]}
emygvnyfairnkkgtelllgvdalglhiydpenrltpkisfpwneirnisysdkeftik
pldkkidvfkfnssklrvnklilqlcignhdlfmrrrka
Timeline for d1h4rb2: