![]() | Class a: All alpha proteins [46456] (218 folds) |
![]() | Fold a.11: Acyl-CoA binding protein-like [47026] (2 superfamilies) core: 3 helices; bundle, closed, left-handed twist; up-and-down |
![]() | Superfamily a.11.2: Second domain of FERM [47031] (1 family) ![]() |
![]() | Family a.11.2.1: Second domain of FERM [47032] (6 proteins) |
![]() | Protein Merlin [68980] (2 species) the neurofibromatosis 2 tumor suppressor protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [68981] (1 PDB entry) |
![]() | Domain d1h4rb1: 1h4r B:104-214 [65619] Other proteins in same PDB: d1h4ra2, d1h4ra3, d1h4rb2, d1h4rb3 |
PDB Entry: 1h4r (more details), 1.8 Å
SCOP Domain Sequences for d1h4rb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1h4rb1 a.11.2.1 (B:104-214) Merlin {Human (Homo sapiens)} naeeelvqeitqhlfflqvkkqildekiycppeasvllasyavqakygdydpsvhkrgfl aqeellpkrvinlyqmtpemweeritawyaehrgrardeaemeylkiaqdl
Timeline for d1h4rb1: