SCOP 1.59: Domain d1h4rb1: 1h4r B:104-214

Lineage for d1h4rb1 (1h4r B:104-214)

1. Root: SCOP 1.59

2. Class a: All alpha proteins [46456] (151 folds)

3. Fold a.11: Acyl-CoA binding protein-like [47026] (2 superfamilies)

4. Superfamily a.11.2: Second domain of FERM [47031] (1 family)

5. Family a.11.2.1: Second domain of FERM [47032] (4 proteins)

6. Protein Merlin [68980] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [68981] (1 PDB entry)

8. Domain d1h4rb1: 1h4r B:104-214 [65619]
   Other proteins in same PDB: d1h4ra2, d1h4ra3, d1h4rb2, d1h4rb3

Details for d1h4rb1

PDB Entry: 1h4r, 1.8 Å

PDB Description: crystal structure of the ferm domain of merlin, the neurofibromatosis 2 tumor suppressor protein.

SCOP Domain Sequences for d1h4rb1:

Sequence; same for both SEQRES and ATOM records:

>d1h4rb1 a.11.2.1 (B:104-214) Merlin {Human (Homo sapiens)}
naeeelvqeitqhlfflqvkkqildekiycppeasvllasyavqakygdydpsvhkrgfl
aqeellpkrvinlyqmtpemweeritawyaehrgrardeaemeylkiaqdl

Timeline for d1h4rb1:

• d1h4rb1 is new in SCOP 1.59
  
• d1h4rb1 appears in SCOP 1.61
  
• d1h4rb1 appears in the current release, SCOPe 2.08