SCOPe 2.05: Domain d1h4ra1: 1h4r A:104-214

Lineage for d1h4ra1 (1h4r A:104-214)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.11: Acyl-CoA binding protein-like [47026] (2 superfamilies)
   core: 3 helices; bundle, closed, left-handed twist; up-and-down

4. Superfamily a.11.2: Second domain of FERM [47031] (2 families)
   automatically mapped to Pfam PF00373

5. Family a.11.2.1: Second domain of FERM [47032] (9 proteins)

6. Protein Merlin [68980] (2 species)
   the neurofibromatosis 2 tumor suppressor protein

7. Species Human (Homo sapiens) [TaxId:9606] [68981] (1 PDB entry)

8. Domain d1h4ra1: 1h4r A:104-214 [65616]
   Other proteins in same PDB: d1h4ra2, d1h4ra3, d1h4rb2, d1h4rb3
   complexed with so4

Details for d1h4ra1

PDB Entry: 1h4r, 1.8 Å

PDB Description: crystal structure of the ferm domain of merlin, the neurofibromatosis 2 tumor suppressor protein.

PDB Compounds: (A:) merlin

SCOPe Domain Sequences for d1h4ra1:

Sequence; same for both SEQRES and ATOM records:

>d1h4ra1 a.11.2.1 (A:104-214) Merlin {Human (Homo sapiens) [TaxId: 9606]}
naeeelvqeitqhlfflqvkkqildekiycppeasvllasyavqakygdydpsvhkrgfl
aqeellpkrvinlyqmtpemweeritawyaehrgrardeaemeylkiaqdl

Timeline for d1h4ra1:

• d1h4ra1 first appeared in SCOP 1.59
  
• d1h4ra1 appears in SCOPe 2.04
  
• d1h4ra1 appears in SCOPe 2.06
  
• d1h4ra1 appears in the current release, SCOPe 2.08