Lineage for d1h4ra1 (1h4r A:104-214)

  1. Root: SCOP 1.65
  2. 275720Class a: All alpha proteins [46456] (179 folds)
  3. 278829Fold a.11: Acyl-CoA binding protein-like [47026] (2 superfamilies)
    core: 3 helices; bundle, closed, left-handed twist; up-and-down
  4. 278842Superfamily a.11.2: Second domain of FERM [47031] (1 family) (S)
  5. 278843Family a.11.2.1: Second domain of FERM [47032] (6 proteins)
  6. 278853Protein Merlin [68980] (2 species)
    the neurofibromatosis 2 tumor suppressor protein
  7. 278854Species Human (Homo sapiens) [TaxId:9606] [68981] (1 PDB entry)
  8. 278855Domain d1h4ra1: 1h4r A:104-214 [65616]
    Other proteins in same PDB: d1h4ra2, d1h4ra3, d1h4rb2, d1h4rb3

Details for d1h4ra1

PDB Entry: 1h4r (more details), 1.8 Å

PDB Description: crystal structure of the ferm domain of merlin, the neurofibromatosis 2 tumor suppressor protein.

SCOP Domain Sequences for d1h4ra1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h4ra1 a.11.2.1 (A:104-214) Merlin {Human (Homo sapiens)}
naeeelvqeitqhlfflqvkkqildekiycppeasvllasyavqakygdydpsvhkrgfl
aqeellpkrvinlyqmtpemweeritawyaehrgrardeaemeylkiaqdl

SCOP Domain Coordinates for d1h4ra1:

Click to download the PDB-style file with coordinates for d1h4ra1.
(The format of our PDB-style files is described here.)

Timeline for d1h4ra1: