Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest |
Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) Similar in architecture to the superfamily I but partly differs in topology |
Family c.94.1.2: Transferrin [53888] (4 proteins) further duplication: composed of two two-domain lobes |
Protein Ovotransferrin [53894] (2 species) |
Species Duck (Anas platyrhynchos) [TaxId:8839] [53895] (5 PDB entries) |
Domain d1gv8a_: 1gv8 A: [65606] domain II in the N-terminal lobe complexed with co3, fe, gly |
PDB Entry: 1gv8 (more details), 1.95 Å
SCOPe Domain Sequences for d1gv8a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gv8a_ c.94.1.2 (A:) Ovotransferrin {Duck (Anas platyrhynchos) [TaxId: 8839]} syyavavvkkgtdfmikdlrgktschtglgrsagwnipigtlihrgdiewegiesgsveq avakffsascvpgatteqklcrqckgdaktkclrnapysgysgafqclkdgkgdvafvkh ttvqenapeekdeyellcldgtrqpvdsyktcnwarvaa
Timeline for d1gv8a_: