Lineage for d1gv8a_ (1gv8 A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1879042Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 1879043Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 1880102Family c.94.1.2: Transferrin [53888] (4 proteins)
    further duplication: composed of two two-domain lobes
  6. 1880178Protein Ovotransferrin [53894] (2 species)
  7. 1880193Species Duck (Anas platyrhynchos) [TaxId:8839] [53895] (5 PDB entries)
  8. 1880194Domain d1gv8a_: 1gv8 A: [65606]
    domain II in the N-terminal lobe
    complexed with co3, fe, gly

Details for d1gv8a_

PDB Entry: 1gv8 (more details), 1.95 Å

PDB Description: 18 kda fragment of n-ii domain of duck ovotransferrin
PDB Compounds: (A:) Ovotransferrin

SCOPe Domain Sequences for d1gv8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gv8a_ c.94.1.2 (A:) Ovotransferrin {Duck (Anas platyrhynchos) [TaxId: 8839]}
syyavavvkkgtdfmikdlrgktschtglgrsagwnipigtlihrgdiewegiesgsveq
avakffsascvpgatteqklcrqckgdaktkclrnapysgysgafqclkdgkgdvafvkh
ttvqenapeekdeyellcldgtrqpvdsyktcnwarvaa

SCOPe Domain Coordinates for d1gv8a_:

Click to download the PDB-style file with coordinates for d1gv8a_.
(The format of our PDB-style files is described here.)

Timeline for d1gv8a_: