Lineage for d1gv1b2 (1gv1 B:143-299)

  1. Root: SCOP 1.59
  2. 128814Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
  3. 138998Fold d.162: Lactate & malate dehydrogenases, C-terminal domain [56326] (1 superfamily)
  4. 138999Superfamily d.162.1: Lactate & malate dehydrogenases, C-terminal domain [56327] (1 family) (S)
  5. 139000Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (4 proteins)
  6. 139061Protein Malate dehydrogenase [56329] (10 species)
  7. 139076Species Chlorobium vibrioforme [TaxId:1098] [69842] (2 PDB entries)
  8. 139082Domain d1gv1b2: 1gv1 B:143-299 [65601]
    Other proteins in same PDB: d1gv1a1, d1gv1b1, d1gv1c1, d1gv1d1

Details for d1gv1b2

PDB Entry: 1gv1 (more details), 2.5 Å

PDB Description: structural basis for thermophilic protein stability: structures of thermophilic and mesophilic malate dehydrogenases

SCOP Domain Sequences for d1gv1b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gv1b2 d.162.1.1 (B:143-299) Malate dehydrogenase {Chlorobium vibrioforme}
agvldaarfrsfiamelgvsmqdinacvlgghgdamvpvvkyttvagipisdllpaetid
klvertrnggaeivehlkqgsafyapassvvemvesivldrkrvlpcavglegqygidkt
fvgvpvklgrngveqiyeinldqadldllqksakivd

SCOP Domain Coordinates for d1gv1b2:

Click to download the PDB-style file with coordinates for d1gv1b2.
(The format of our PDB-style files is described here.)

Timeline for d1gv1b2: