Lineage for d1guzc2 (1guz C:143-305)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1680346Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
    unusual fold, defines family
  4. 1680347Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) (S)
  5. 1680348Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (5 proteins)
    N-terminal domain is NAD-binding module (alpha/beta Rossmann-fold domain)
    automatically mapped to Pfam PF02866
  6. 1680540Protein Malate dehydrogenase [56329] (12 species)
  7. 1680548Species Chlorobium vibrioforme [TaxId:1098] [69842] (2 PDB entries)
  8. 1680551Domain d1guzc2: 1guz C:143-305 [65591]
    Other proteins in same PDB: d1guza1, d1guzb1, d1guzc1, d1guzd1
    complexed with nad

Details for d1guzc2

PDB Entry: 1guz (more details), 2 Å

PDB Description: structural basis for thermophilic protein stability: structures of thermophilic and mesophilic malate dehydrogenases
PDB Compounds: (C:) malate dehydrogenase

SCOPe Domain Sequences for d1guzc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1guzc2 d.162.1.1 (C:143-305) Malate dehydrogenase {Chlorobium vibrioforme [TaxId: 1098]}
agvldaarfrsfiamelgvsmqdinacvlgghgdamvpvvkyttvagipisdllpaetid
klvertrnggaeivehlkqgsafyapassvvemvesivldrkrvlpcavglegqygidkt
fvgvpvklgrngveqiyeinldqadldllqksakivdenckml

SCOPe Domain Coordinates for d1guzc2:

Click to download the PDB-style file with coordinates for d1guzc2.
(The format of our PDB-style files is described here.)

Timeline for d1guzc2: