SCOPe 2.07: Domain d1guzc1: 1guz C:1-142

Lineage for d1guzc1 (1guz C:1-142)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.5: LDH N-terminal domain-like [51848] (9 proteins)

6. Protein Malate dehydrogenase [51849] (13 species)

7. Species Chlorobium vibrioforme [TaxId:1098] [69417] (2 PDB entries)

8. Domain d1guzc1: 1guz C:1-142 [65590]
   Other proteins in same PDB: d1guza2, d1guzb2, d1guzc2, d1guzd2
   complexed with nad

Details for d1guzc1

PDB Entry: 1guz, 2 Å

PDB Description: structural basis for thermophilic protein stability: structures of thermophilic and mesophilic malate dehydrogenases

PDB Compounds: (C:) malate dehydrogenase

SCOPe Domain Sequences for d1guzc1:

Sequence; same for both SEQRES and ATOM records:

>d1guzc1 c.2.1.5 (C:1-142) Malate dehydrogenase {Chlorobium vibrioforme [TaxId: 1098]}
mkitvigagnvgattafrlaekqlarelvlldvvegipqgkaldmyesgpvglfdtkvtg
sndyadtansdiviitaglprkpgmtredllmknagivkevtdnimkhsknpiiivvsnp
ldimthvawvrsglpkervigm

Timeline for d1guzc1:

• d1guzc1 first appeared in SCOP 1.59
  
• d1guzc1 appears in SCOPe 2.06
  
• d1guzc1 appears in the current release, SCOPe 2.08