SCOPe 2.04: Domain d1guzb2: 1guz B:143-305

Lineage for d1guzb2 (1guz B:143-305)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
   unusual fold, defines family

4. Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families)

5. Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (5 proteins)
   N-terminal domain is NAD-binding module (alpha/beta Rossmann-fold domain)
   automatically mapped to Pfam PF02866

6. Protein Malate dehydrogenase [56329] (12 species)

7. Species Chlorobium vibrioforme [TaxId:1098] [69842] (2 PDB entries)

8. Domain d1guzb2: 1guz B:143-305 [65589]
   Other proteins in same PDB: d1guza1, d1guzb1, d1guzc1, d1guzd1
   complexed with nad

Details for d1guzb2

PDB Entry: 1guz, 2 Å

PDB Description: structural basis for thermophilic protein stability: structures of thermophilic and mesophilic malate dehydrogenases

PDB Compounds: (B:) malate dehydrogenase

SCOPe Domain Sequences for d1guzb2:

Sequence; same for both SEQRES and ATOM records:

>d1guzb2 d.162.1.1 (B:143-305) Malate dehydrogenase {Chlorobium vibrioforme [TaxId: 1098]}
agvldaarfrsfiamelgvsmqdinacvlgghgdamvpvvkyttvagipisdllpaetid
klvertrnggaeivehlkqgsafyapassvvemvesivldrkrvlpcavglegqygidkt
fvgvpvklgrngveqiyeinldqadldllqksakivdenckml

Timeline for d1guzb2:

• d1guzb2 first appeared in SCOP 1.59
  
• d1guzb2 appears in SCOPe 2.03
  
• d1guzb2 appears in SCOPe 2.05
  
• d1guzb2 appears in the current release, SCOPe 2.08