SCOP 1.69: Domain d1guyc1: 1guy C:1-143

Lineage for d1guyc1 (1guy C:1-143)

1. Root: SCOP 1.69

2. Class c: Alpha and beta proteins (a/b) [51349] (136 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families)

5. Family c.2.1.5: LDH N-terminal domain-like [51848] (8 proteins)

6. Protein Malate dehydrogenase [51849] (12 species)

7. Species Chloroflexus aurantiacus [69415] (7 PDB entries)

8. Domain d1guyc1: 1guy C:1-143 [65584]
   Other proteins in same PDB: d1guya2, d1guyc2

Details for d1guyc1

PDB Entry: 1guy, 2.2 Å

PDB Description: structural basis for thermophilic protein stability: structures of thermophilic and mesophilic malate dehydrogenases

SCOP Domain Sequences for d1guyc1:

Sequence, based on SEQRES records:

>d1guyc1 c.2.1.5 (C:1-143) Malate dehydrogenase {Chloroflexus aurantiacus}
mrkkisiigagfvgsttahwlaakelgdivlldivegvpqgkaldlyeaspiegfdvrvt
gtnnyadtansdvivvtsgaprkpgmsredlikvnaditracisqaaplspnaviimvnn
pldamtylaaevsgfpkervigq

Sequence, based on observed residues (ATOM records):

>d1guyc1 c.2.1.5 (C:1-143) Malate dehydrogenase {Chloroflexus aurantiacus}
mrkkisiigagfvgsttahwlaakelgdivlldivegvpqgkaldlyeaspiegfdvrvt
gtnnyadtansdvivvtsgasredlikvnaditracisqaaplspnaviimvnnpldamt
ylaaevsgfpkervigq

Timeline for d1guyc1:

• d1guyc1 first appeared in SCOP 1.59
  
• d1guyc1 appears in SCOP 1.67
  
• d1guyc1 appears in SCOP 1.71
  
• d1guyc1 appears in the current release, SCOPe 2.08