Lineage for d1guyc1 (1guy C:1-143)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 117972Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
  4. 117973Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (10 families) (S)
  5. 118692Family c.2.1.5: Lactate & malate dehydrogenases, N-terminal domain [51848] (4 proteins)
  6. 118753Protein Malate dehydrogenase [51849] (10 species)
  7. 118777Species Chloroflexus aurantiacus [69415] (1 PDB entry)
  8. 118779Domain d1guyc1: 1guy C:1-143 [65584]
    Other proteins in same PDB: d1guya2, d1guyc2

Details for d1guyc1

PDB Entry: 1guy (more details), 2.2 Å

PDB Description: structural basis for thermophilic protein stability: structures of thermophilic and mesophilic malate dehydrogenases

SCOP Domain Sequences for d1guyc1:

Sequence, based on SEQRES records: (download)

>d1guyc1 c.2.1.5 (C:1-143) Malate dehydrogenase {Chloroflexus aurantiacus}
mrkkisiigagfvgsttahwlaakelgdivlldivegvpqgkaldlyeaspiegfdvrvt
gtnnyadtansdvivvtsgaprkpgmsredlikvnaditracisqaaplspnaviimvnn
pldamtylaaevsgfpkervigq

Sequence, based on observed residues (ATOM records): (download)

>d1guyc1 c.2.1.5 (C:1-143) Malate dehydrogenase {Chloroflexus aurantiacus}
mrkkisiigagfvgsttahwlaakelgdivlldivegvpqgkaldlyeaspiegfdvrvt
gtnnyadtansdvivvtsgasredlikvnaditracisqaaplspnaviimvnnpldamt
ylaaevsgfpkervigq

SCOP Domain Coordinates for d1guyc1:

Click to download the PDB-style file with coordinates for d1guyc1.
(The format of our PDB-style files is described here.)

Timeline for d1guyc1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1guyc2