SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d1gu9l_ (1gu9 L:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2013445Fold a.152: AhpD-like [69117] (1 superfamily)
    multihelical; contains 4-helical bundle and 2-helical arm
  4. 2013446Superfamily a.152.1: AhpD-like [69118] (4 families) (S)
    probable biological unit contains six domains of this fold arranged with 32 symmetry
  5. 2013447Family a.152.1.1: AhpD [69119] (2 protein domains)
    duplication: two-domain subunits form a helix-swapped trimer
  6. 2013448Protein Antioxidant defense protein AhpD [69120] (1 species)
    a novel enzyme with thioredoxin-like activity
  7. 2013449Species Mycobacterium tuberculosis [TaxId:1773] [69121] (4 PDB entries)
  8. 2013464Domain d1gu9l_: 1gu9 L: [65551]

Details for d1gu9l_

PDB Entry: 1gu9 (more details), 1.9 Å

PDB Description: crystal structure of mycobacterium tuberculosis alkylperoxidase ahpd
PDB Compounds: (L:) alkylhydroperoxidase d

SCOPe Domain Sequences for d1gu9l_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gu9l_ a.152.1.1 (L:) Antioxidant defense protein AhpD {Mycobacterium tuberculosis [TaxId: 1773]}
eklkaalpeyakdiklnlssitrssvldqeqlwgtllasaaatrnpqvladigaeatdhl
saaarhaalgaaaimgmnnvfyrgrgflegryddlrpglrmniianpgipkanfelwsfa
vsaingcshclvahehtlrtvgvdreaifealkaaaivsgvaqalati

SCOPe Domain Coordinates for d1gu9l_:

Click to download the PDB-style file with coordinates for d1gu9l_.
(The format of our PDB-style files is described here.)

Timeline for d1gu9l_: