Lineage for d1gu9e_ (1gu9 E:)

  1. Root: SCOP 1.59
  2. 93448Class a: All alpha proteins [46456] (151 folds)
  3. 101906Fold a.152: Antioxidant defence protein AhpD [69117] (1 superfamily)
  4. 101907Superfamily a.152.1: Antioxidant defence protein AhpD [69118] (1 family) (S)
  5. 101908Family a.152.1.1: Antioxidant defence protein AhpD [69119] (1 protein)
  6. 101909Protein Antioxidant defence protein AhpD [69120] (1 species)
  7. 101910Species Mycobacterium tuberculosis [TaxId:1773] [69121] (2 PDB entries)
  8. 101918Domain d1gu9e_: 1gu9 E: [65544]

Details for d1gu9e_

PDB Entry: 1gu9 (more details), 1.9 Å

PDB Description: crystal structure of mycobacterium tuberculosis alkylperoxidase ahpd

SCOP Domain Sequences for d1gu9e_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gu9e_ a.152.1.1 (E:) Antioxidant defence protein AhpD {Mycobacterium tuberculosis}
ieklkaalpeyakdiklnlssitrssvldqeqlwgtllasaaatrnpqvladigaeatdh
lsaaarhaalgaaaimgmnnvfyrgrgflegryddlrpglrmniianpgipkanfelwsf
avsaingcshclvahehtlrtvgvdreaifealkaaaivsgvaqalatieals

SCOP Domain Coordinates for d1gu9e_:

Click to download the PDB-style file with coordinates for d1gu9e_.
(The format of our PDB-style files is described here.)

Timeline for d1gu9e_: