SCOP 1.65: Domain d1gswa_: 1gsw A:

Lineage for d1gswa_ (1gsw A:)

1. Root: SCOP 1.65

2. Class d: Alpha and beta proteins (a+b) [53931] (234 folds)

3. Fold d.110: Profilin-like [55769] (5 superfamilies)
   core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha

4. Superfamily d.110.3: PYP-like sensor domain (PAS domain) [55785] (4 families)
   alpha-beta(2)-alpha(2)-beta(3)

5. Family d.110.3.1: PYP-like [55786] (2 proteins)

6. Protein Photoactive yellow protein, PYP [55787] (1 species)

7. Species Ectothiorhodospira halophila [TaxId:17] [55788] (14 PDB entries)

8. Domain d1gswa_: 1gsw A: [65538]
   complexed with hc4; mutant

Details for d1gswa_

PDB Entry: 1gsw, 1.85 Å

PDB Description: crystal structure of the p65 crystal form of photoactive yellow protein g51s mutant

SCOP Domain Sequences for d1gswa_:

Sequence; same for both SEQRES and ATOM records:

>d1gswa_ d.110.3.1 (A:) Photoactive yellow protein, PYP {Ectothiorhodospira halophila}
vafgsedientlakmddgqldglafgaiqldgdgnilqynaaegditsrdpkqvigknff
kdvapctdspefygkfkegvasgnlntmfeytfdyqmtptkvkvhmkkalsgdsywvfvk
rv

Timeline for d1gswa_:

• d1gswa_ first appeared in SCOP 1.59
  
• d1gswa_ appears in SCOP 1.63
  
• d1gswa_ appears in SCOP 1.67
  
• d1gswa_ appears in the current release, SCOPe 2.08