| Class d: Alpha and beta proteins (a+b) [53931] (234 folds) |
| Fold d.110: Profilin-like [55769] (5 superfamilies) core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha |
Superfamily d.110.3: PYP-like sensor domain (PAS domain) [55785] (4 families) ![]() alpha-beta(2)-alpha(2)-beta(3) |
| Family d.110.3.1: PYP-like [55786] (2 proteins) |
| Protein Photoactive yellow protein, PYP [55787] (1 species) |
| Species Ectothiorhodospira halophila [TaxId:17] [55788] (14 PDB entries) |
| Domain d1gswa_: 1gsw A: [65538] complexed with hc4; mutant |
PDB Entry: 1gsw (more details), 1.85 Å
SCOP Domain Sequences for d1gswa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gswa_ d.110.3.1 (A:) Photoactive yellow protein, PYP {Ectothiorhodospira halophila}
vafgsedientlakmddgqldglafgaiqldgdgnilqynaaegditsrdpkqvigknff
kdvapctdspefygkfkegvasgnlntmfeytfdyqmtptkvkvhmkkalsgdsywvfvk
rv
Timeline for d1gswa_: