Lineage for d1gswa_ (1gsw A:)

  1. Root: SCOP 1.59
  2. 128814Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
  3. 136761Fold d.110: Profilin-like [55769] (4 superfamilies)
  4. 136809Superfamily d.110.3: PYP-like sensor domain [55785] (4 families) (S)
  5. 136810Family d.110.3.1: Photoactive yellow protein, PYP [55786] (1 protein)
  6. 136811Protein Photoactive yellow protein, PYP [55787] (1 species)
  7. 136812Species Ectothiorhodospira halophila [TaxId:17] [55788] (11 PDB entries)
  8. 136820Domain d1gswa_: 1gsw A: [65538]

Details for d1gswa_

PDB Entry: 1gsw (more details), 1.85 Å

PDB Description: crystal structure of the p65 crystal form of photoactive yellow protein g51s mutant

SCOP Domain Sequences for d1gswa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gswa_ d.110.3.1 (A:) Photoactive yellow protein, PYP {Ectothiorhodospira halophila}
vafgsedientlakmddgqldglafgaiqldgdgnilqynaaegditsrdpkqvigknff
kdvapctdspefygkfkegvasgnlntmfeytfdyqmtptkvkvhmkkalsgdsywvfvk
rv

SCOP Domain Coordinates for d1gswa_:

Click to download the PDB-style file with coordinates for d1gswa_.
(The format of our PDB-style files is described here.)

Timeline for d1gswa_: