Lineage for d1gsma2 (1gsm A:91-206)
- Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families) 
Family b.1.1.4: I set domains [49159] (39 proteins) 
Protein Mucosal addressin cell adhesion molecule-1 (MADCAM-1) [49168] (1 species) Species Human (Homo sapiens) [TaxId:9606] [49169] (2 PDB entries) 
Domain d1gsma2: 1gsm A:91-206 [65536]
Details for d1gsma2
PDB Entry: 1gsm (more details), 1.9 Å
PDB Description: a reassessment of the madcam-1 structure and its role in integrin recognition.
PDB Compounds: (A:) mucosal addressin cell adhesion molecule-1SCOPe Domain Sequences for d1gsma2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gsma2 b.1.1.4 (A:91-206) Mucosal addressin cell adhesion molecule-1 (MADCAM-1) {Human (Homo sapiens) [TaxId: 9606]}
afpnqltvspaalvpgdpevactahkvtpvdpnalsfsllvggqelegaqalgpevqeee
eepqgdedvlfrvterwrlpplgtpvppalycqatmrlpglelshrqaipvliegr
SCOPe Domain Coordinates for d1gsma2:
Click to download the PDB-style file with coordinates for d1gsma2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1gsma2:
- d1gsma2 first appeared in SCOP 1.59
- d1gsma2 appears in SCOPe 2.07
View in 3D
