| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.4: I set domains [49159] (39 proteins) |
| Protein Mucosal addressin cell adhesion molecule-1 (MADCAM-1) [49168] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [49169] (2 PDB entries) |
| Domain d1gsma2: 1gsm A:91-206 [65536] |
PDB Entry: 1gsm (more details), 1.9 Å
SCOPe Domain Sequences for d1gsma2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gsma2 b.1.1.4 (A:91-206) Mucosal addressin cell adhesion molecule-1 (MADCAM-1) {Human (Homo sapiens) [TaxId: 9606]}
afpnqltvspaalvpgdpevactahkvtpvdpnalsfsllvggqelegaqalgpevqeee
eepqgdedvlfrvterwrlpplgtpvppalycqatmrlpglelshrqaipvliegr
Timeline for d1gsma2: