Lineage for d1gs7a2 (1gs7 A:160-336)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 369112Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 369113Superfamily b.6.1: Cupredoxins [49503] (5 families) (S)
    contains copper-binding site
  5. 369433Family b.6.1.3: Multidomain cupredoxins [49550] (6 proteins)
  6. 369511Protein Nitrite reductase, NIR [49551] (4 species)
    consists of two domains of this fold
  7. 369660Species Alcaligenes xylosoxidans [TaxId:85698] [49554] (11 PDB entries)
  8. 369666Domain d1gs7a2: 1gs7 A:160-336 [65532]
    complexed with cu, zn; mutant

Details for d1gs7a2

PDB Entry: 1gs7 (more details), 1.85 Å

PDB Description: crystal structure of h254f mutant of alcaligenes xylosoxidans nitrite reductase

SCOP Domain Sequences for d1gs7a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gs7a2 b.6.1.3 (A:160-336) Nitrite reductase, NIR {Alcaligenes xylosoxidans}
qgkplhydraytigefdlyipkgpdgkykdyatlaesygdtvqvmrtltpshivfngkvg
altganaltakvgetvllihsqanrdtrphliggfgdwvwetgkfanppqrdletwfirg
gsagaalytfkqpgvyaylnhnlieafelgaaghikvegkwnddlmkqikapapipr

SCOP Domain Coordinates for d1gs7a2:

Click to download the PDB-style file with coordinates for d1gs7a2.
(The format of our PDB-style files is described here.)

Timeline for d1gs7a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1gs7a1