Lineage for d1gs7a2 (1gs7 A:160-336)
- Root: SCOP 1.61
Class b: All beta proteins [48724] (111 folds) 
Fold b.6: Cupredoxin-like [49502] (2 superfamilies) Superfamily b.6.1: Cupredoxins [49503] (5 families) 
Family b.6.1.3: Multidomain cupredoxins [49550] (5 proteins) 
Protein Nitrite reductase, NIR [49551] (4 species) 
Species Alcaligenes xylosoxidans [TaxId:85698] [49554] (9 PDB entries) 
Domain d1gs7a2: 1gs7 A:160-336 [65532]
Details for d1gs7a2
PDB Entry: 1gs7 (more details), 1.85 Å
PDB Description: crystal structure of h254f mutant of alcaligenes xylosoxidans nitrite reductase
SCOP Domain Sequences for d1gs7a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gs7a2 b.6.1.3 (A:160-336) Nitrite reductase, NIR {Alcaligenes xylosoxidans}
qgkplhydraytigefdlyipkgpdgkykdyatlaesygdtvqvmrtltpshivfngkvg
altganaltakvgetvllihsqanrdtrphliggfgdwvwetgkfanppqrdletwfirg
gsagaalytfkqpgvyaylnhnlieafelgaaghikvegkwnddlmkqikapapipr
SCOP Domain Coordinates for d1gs7a2:
Click to download the PDB-style file with coordinates for d1gs7a2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1gs7a2:
- d1gs7a2 first appeared in SCOP 1.59
- d1gs7a2 appears in SCOP 1.63
- d1gs7a2 appears in the current release, SCOPe 2.08
View in 3D
