Lineage for d1gs7a2 (1gs7 A:160-336)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 106628Fold b.6: Cupredoxins [49502] (1 superfamily)
  4. 106629Superfamily b.6.1: Cupredoxins [49503] (4 families) (S)
  5. 106913Family b.6.1.3: Multidomain cupredoxins [49550] (5 protein domains)
  6. 106961Protein Nitrite reductase, NIR [49551] (4 species)
  7. 107048Species Alcaligenes xylosoxidans [TaxId:85698] [49554] (9 PDB entries)
  8. 107050Domain d1gs7a2: 1gs7 A:160-336 [65532]

Details for d1gs7a2

PDB Entry: 1gs7 (more details), 1.85 Å

PDB Description: crystal structure of h254f mutant of alcaligenes xylosoxidans nitrite reductase

SCOP Domain Sequences for d1gs7a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gs7a2 b.6.1.3 (A:160-336) Nitrite reductase, NIR {Alcaligenes xylosoxidans}
qgkplhydraytigefdlyipkgpdgkykdyatlaesygdtvqvmrtltpshivfngkvg
altganaltakvgetvllihsqanrdtrphliggfgdwvwetgkfanppqrdletwfirg
gsagaalytfkqpgvyaylnhnlieafelgaaghikvegkwnddlmkqikapapipr

SCOP Domain Coordinates for d1gs7a2:

Click to download the PDB-style file with coordinates for d1gs7a2.
(The format of our PDB-style files is described here.)

Timeline for d1gs7a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1gs7a1