Class b: All beta proteins [48724] (180 folds) |
Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
Superfamily b.6.1: Cupredoxins [49503] (8 families) contains copper-binding site |
Family b.6.1.3: Multidomain cupredoxins [49550] (15 proteins) |
Protein Nitrite reductase, NIR, C-terminal domain [418911] (5 species) |
Species Alcaligenes xylosoxidans [TaxId:85698] [419329] (24 PDB entries) Uniprot O68601 |
Domain d1gs7a2: 1gs7 A:160-336 [65532] Other proteins in same PDB: d1gs7a1 complexed with cu, zn; mutant has additional insertions and/or extensions that are not grouped together |
PDB Entry: 1gs7 (more details), 1.85 Å
SCOPe Domain Sequences for d1gs7a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gs7a2 b.6.1.3 (A:160-336) Nitrite reductase, NIR, C-terminal domain {Alcaligenes xylosoxidans [TaxId: 85698]} qgkplhydraytigefdlyipkgpdgkykdyatlaesygdtvqvmrtltpshivfngkvg altganaltakvgetvllihsqanrdtrphliggfgdwvwetgkfanppqrdletwfirg gsagaalytfkqpgvyaylnhnlieafelgaaghikvegkwnddlmkqikapapipr
Timeline for d1gs7a2: