Class b: All beta proteins [48724] (174 folds) |
Fold b.22: TNF-like [49841] (1 superfamily) sandwich, 10 strands in 2 sheets; jelly-roll |
Superfamily b.22.1: TNF-like [49842] (2 families) |
Family b.22.1.1: TNF-like [49843] (15 proteins) |
Protein Collagen NC1 trimerisation domain [69230] (2 species) |
Species Human (Homo sapiens), isoform X [TaxId:9606] [69231] (1 PDB entry) |
Domain d1gr3a_: 1gr3 A: [65476] complexed with ca, cps, na |
PDB Entry: 1gr3 (more details), 2 Å
SCOPe Domain Sequences for d1gr3a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gr3a_ b.22.1.1 (A:) Collagen NC1 trimerisation domain {Human (Homo sapiens), isoform X [TaxId: 9606]} mpvsaftvilskaypaigtpipfdkilynrqqhydprtgiftcqipgiyyfsyhvhvkgt hvwvglykngtpvmytydeytkgyldqasgsaiidltendqvwlqlpnaesnglysseyv hssfsgflvapm
Timeline for d1gr3a_: