Lineage for d1gqcb_ (1gqc B:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2505843Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest
  4. 2505844Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families) (S)
  5. 2506554Family c.68.1.13: Cytidylytransferase [68901] (7 proteins)
  6. 2506609Protein CMP:2-keto-3-deoxy-manno-octonic acid (CMP-KDO)synthetase [64143] (3 species)
  7. 2506615Species Escherichia coli, KpsU [TaxId:562] [64144] (8 PDB entries)
    capsule-specific enzyme
  8. 2506627Domain d1gqcb_: 1gqc B: [65469]
    complexed with c5p, cmk, mg

Details for d1gqcb_

PDB Entry: 1gqc (more details), 2.6 Å

PDB Description: the structure of cmp:2-keto-3-deoxy-manno-octonic acid synthetase complexed with cmp-kdo at 100k
PDB Compounds: (B:) 3-deoxy-manno-octulosonate cytidylyltransferase

SCOPe Domain Sequences for d1gqcb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gqcb_ c.68.1.13 (B:) CMP:2-keto-3-deoxy-manno-octonic acid (CMP-KDO)synthetase {Escherichia coli, KpsU [TaxId: 562]}
skaviviparygssrlpgkplldivgkpmiqhvyeralqvagvaevwvatddprveqavq
afggkaimtrndhesgtdrlvevmhkveadiyinlqgdepmirprdvetllqgmrddpal
pvatlchaisaaeaaepstvkvvvntrqdalyfsrspipyprnaekarylkhvgiyayrr
dvlqnysqlpesmpeqaesleqlrlmnaginirtfevaatgpgvdtpaclekvralmaqe
l

SCOPe Domain Coordinates for d1gqcb_:

Click to download the PDB-style file with coordinates for d1gqcb_.
(The format of our PDB-style files is described here.)

Timeline for d1gqcb_: