Lineage for d1gqca_ (1gqc A:)
- Root: SCOP 1.59
Class c: Alpha and beta proteins (a/b) [51349] (113 folds) 
Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily) Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (11 families) 
Family c.68.1.13: Cytidylytransferase [68901] (3 proteins) 
Protein CMP:2-keto-3-deoxy-manno-octonic acid (CMP-KDO)synthetase, KdsB [64143] (1 species) Species Escherichia coli [TaxId:562] [64144] (8 PDB entries) 
Domain d1gqca_: 1gqc A: [65468]
Details for d1gqca_
PDB Entry: 1gqc (more details), 2.6 Å
PDB Description: the structure of cmp:2-keto-3-deoxy-manno-octonic acid synthetase complexed with cmp-kdo at 100k
SCOP Domain Sequences for d1gqca_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gqca_ c.68.1.13 (A:) CMP:2-keto-3-deoxy-manno-octonic acid (CMP-KDO)synthetase, KdsB {Escherichia coli}
skaviviparygssrlpgkplldivgkpmiqhvyeralqvagvaevwvatddprveqavq
afggkaimtrndhesgtdrlvevmhkveadiyinlqgdepmirprdvetllqgmrddpal
pvatlchaisaaeaaepstvkvvvntrqdalyfsrspipyprnaekarylkhvgiyayrr
dvlqnysqlpesmpeqaesleqlrlmnaginirtfevaatgpgvdtpaclekvralmaqe
la
SCOP Domain Coordinates for d1gqca_:
Click to download the PDB-style file with coordinates for d1gqca_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1gqca_:
- d1gqca_ is new in SCOP 1.59
- d1gqca_ appears in SCOP 1.61
- d1gqca_ appears in the current release, SCOPe 2.08
View in 3D
