Lineage for d1gq9b_ (1gq9 B:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2149496Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest
  4. 2149497Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families) (S)
  5. 2150158Family c.68.1.13: Cytidylytransferase [68901] (7 proteins)
  6. 2150205Protein CMP:2-keto-3-deoxy-manno-octonic acid (CMP-KDO)synthetase [64143] (3 species)
  7. 2150211Species Escherichia coli, KpsU [TaxId:562] [64144] (8 PDB entries)
    capsule-specific enzyme
  8. 2150225Domain d1gq9b_: 1gq9 B: [65467]
    complexed with ctp, mg

Details for d1gq9b_

PDB Entry: 1gq9 (more details), 2.6 Å

PDB Description: the structure of cmp:2-keto-3-deoxy-manno-octonic acid synthetase complexed with ctp at 100k
PDB Compounds: (B:) 3-deoxy-manno-octulosonate cytidylyltransferase

SCOPe Domain Sequences for d1gq9b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gq9b_ c.68.1.13 (B:) CMP:2-keto-3-deoxy-manno-octonic acid (CMP-KDO)synthetase {Escherichia coli, KpsU [TaxId: 562]}
skaviviparygssrlpgkplldivgkpmiqhvyeralqvagvaevwvatddprveqavq
afggkaimtrndhesgtdrlvevmhkveadiyinlqgdepmirprdvetllqgmrddpal
pvatlchaisaaeaaepstvkvvvntrqdalyfsrspipyprnaekarylkhvgiyayrr
dvlqnysqlpesmpeqaesleqlrlmnaginirtfevaatgpgvdtpaclekvralmaqe
l

SCOPe Domain Coordinates for d1gq9b_:

Click to download the PDB-style file with coordinates for d1gq9b_.
(The format of our PDB-style files is described here.)

Timeline for d1gq9b_: