Lineage for d1gq9b_ (1gq9 B:)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 126172Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily)
  4. 126173Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (11 families) (S)
  5. 126331Family c.68.1.13: Cytidylytransferase [68901] (3 proteins)
  6. 126337Protein CMP:2-keto-3-deoxy-manno-octonic acid (CMP-KDO)synthetase, KdsB [64143] (1 species)
  7. 126338Species Escherichia coli [TaxId:562] [64144] (8 PDB entries)
  8. 126352Domain d1gq9b_: 1gq9 B: [65467]

Details for d1gq9b_

PDB Entry: 1gq9 (more details), 2.6 Å

PDB Description: the structure of cmp:2-keto-3-deoxy-manno-octonic acid synthetase complexed with ctp at 100k

SCOP Domain Sequences for d1gq9b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gq9b_ c.68.1.13 (B:) CMP:2-keto-3-deoxy-manno-octonic acid (CMP-KDO)synthetase, KdsB {Escherichia coli}
skaviviparygssrlpgkplldivgkpmiqhvyeralqvagvaevwvatddprveqavq
afggkaimtrndhesgtdrlvevmhkveadiyinlqgdepmirprdvetllqgmrddpal
pvatlchaisaaeaaepstvkvvvntrqdalyfsrspipyprnaekarylkhvgiyayrr
dvlqnysqlpesmpeqaesleqlrlmnaginirtfevaatgpgvdtpaclekvralmaqe
l

SCOP Domain Coordinates for d1gq9b_:

Click to download the PDB-style file with coordinates for d1gq9b_.
(The format of our PDB-style files is described here.)

Timeline for d1gq9b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1gq9a_