SCOPe 2.03: Domain d1gpwf_: 1gpw F:

Lineage for d1gpwf_ (1gpw F:)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (10 families)
   conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures

5. Family c.23.16.1: Class I glutamine amidotransferases (GAT) [52318] (12 proteins)
   contains a catalytic Cys-His-Glu triad

6. Protein GAT subunit, HisH, (or domain) of imidazoleglycerolphosphate synthase HisF [69447] (3 species)

7. Species Thermotoga maritima [TaxId:2336] [69448] (5 PDB entries)

8. Domain d1gpwf_: 1gpw F: [65465]
   Other proteins in same PDB: d1gpwa_, d1gpwc_, d1gpwe_
   complexed with po4

Details for d1gpwf_

PDB Entry: 1gpw, 2.4 Å

PDB Description: structural evidence for ammonia tunneling across the (beta/alpha)8 barrel of the imidazole glycerol phosphate synthase bienzyme complex.

PDB Compounds: (F:) amidotransferase hish

SCOPe Domain Sequences for d1gpwf_:

Sequence; same for both SEQRES and ATOM records:

>d1gpwf_ c.23.16.1 (F:) GAT subunit, HisH, (or domain) of imidazoleglycerolphosphate synthase HisF {Thermotoga maritima [TaxId: 2336]}
mrigiisvgpgnimnlyrgvkrasenfedvsielvesprndlydllfipgvghfgegmrr
lrendlidfvrkhvederyvvgvclgmqllfeeseeapgvkglsliegnvvklrsrrlph
mgwnevifkdtfpngyyyfvhtyravceeehvlgtteydgeifpsavrkgrilgfqfhpe
ksskigrkllekviecslsrr

Timeline for d1gpwf_:

• d1gpwf_ first appeared in SCOP 1.59
  
• d1gpwf_ appears in SCOPe 2.02
  
• d1gpwf_ appears in SCOPe 2.04
  
• d1gpwf_ appears in the current release, SCOPe 2.08