SCOP 1.69: Domain d1gpwa_: 1gpw A:

Lineage for d1gpwa_ (1gpw A:)

1. Root: SCOP 1.69

2. Class c: Alpha and beta proteins (a/b) [51349] (136 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (31 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (4 families)

5. Family c.1.2.1: Histidine biosynthesis enzymes [51367] (2 proteins)
   structural evidence for the gene duplication within the barrel fold

6. Protein Cyclase subunit (or domain) of imidazoleglycerolphosphate synthase HisF [51370] (4 species)

7. Species Thermotoga maritima [TaxId:243274] [51371] (3 PDB entries)

8. Domain d1gpwa_: 1gpw A: [65460]
   Other proteins in same PDB: d1gpwb_, d1gpwd_, d1gpwf_

Details for d1gpwa_

PDB Entry: 1gpw, 2.4 Å

PDB Description: structural evidence for ammonia tunneling across the (beta/alpha)8 barrel of the imidazole glycerol phosphate synthase bienzyme complex.

SCOP Domain Sequences for d1gpwa_:

Sequence; same for both SEQRES and ATOM records:

>d1gpwa_ c.1.2.1 (A:) Cyclase subunit (or domain) of imidazoleglycerolphosphate synthase HisF {Thermotoga maritima}
mlakriiaclnvkdgrvvkgtnfenlrdsgdpvelgkfyseigidelvflditasvekrk
tmlelvekvaeqidipftvgggihdfetaselilrgadkvsintaavenpslitqiaqtf
gsqavvvaidakrvdgefmvftysgkkntgillrdwvvevekrgageilltsidrdgtks
gydtemirfvrplttlpiiasggagkmehfleaflagadaalaasvfhfreidvrelkey
lkkhgvnvrlegl

Timeline for d1gpwa_:

• d1gpwa_ first appeared in SCOP 1.59
  
• d1gpwa_ appears in SCOP 1.67
  
• d1gpwa_ appears in SCOP 1.71
  
• d1gpwa_ appears in the current release, SCOPe 2.08