Lineage for d1gpub3 (1gpu B:535-680)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2488514Fold c.48: TK C-terminal domain-like [52921] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 13245, strand 1 is antiparallel to the rest
  4. 2488515Superfamily c.48.1: TK C-terminal domain-like [52922] (4 families) (S)
  5. 2488516Family c.48.1.1: Transketolase C-terminal domain-like [52923] (2 proteins)
  6. 2488535Protein Transketolase (TK), C-domain [52924] (4 species)
    two N-terminal domains are PP and Pyr modules of thiamin-binding fold
  7. 2488536Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [52925] (7 PDB entries)
  8. 2488538Domain d1gpub3: 1gpu B:535-680 [65459]
    Other proteins in same PDB: d1gpua1, d1gpua2, d1gpub1, d1gpub2
    complexed with ca, thd

Details for d1gpub3

PDB Entry: 1gpu (more details), 1.86 Å

PDB Description: transketolase complex with reaction intermediate
PDB Compounds: (B:) Transketolase 1

SCOPe Domain Sequences for d1gpub3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gpub3 c.48.1.1 (B:535-680) Transketolase (TK), C-domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
egssiesaskggyvlqdvanpdiilvatgsevslsveaaktlaaknikarvvslpdfftf
dkqpleyrlsvlpdnvpimsvevlattcwgkyahqsfgidrfgasgkapevfkffgftpe
gvaeraqktiafykgdklisplkkaf

SCOPe Domain Coordinates for d1gpub3:

Click to download the PDB-style file with coordinates for d1gpub3.
(The format of our PDB-style files is described here.)

Timeline for d1gpub3: