| Class c: Alpha and beta proteins (a/b) [51349] (121 folds) |
| Fold c.48: TK C-terminal domain-like [52921] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 13245, strand 1 is antiparallel to the rest |
Superfamily c.48.1: TK C-terminal domain-like [52922] (3 families) ![]() |
| Family c.48.1.1: Transketolase C-terminal domain-like [52923] (2 proteins) |
| Protein Transketolase (TK), C-domain [52924] (3 species) two N-terminal domains are PP and Pyr modules of thiamin-binding fold |
| Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [52925] (7 PDB entries) |
| Domain d1gpua3: 1gpu A:535-680 [65456] Other proteins in same PDB: d1gpua1, d1gpua2, d1gpub1, d1gpub2 |
PDB Entry: 1gpu (more details), 1.86 Å
SCOP Domain Sequences for d1gpua3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gpua3 c.48.1.1 (A:535-680) Transketolase (TK), C-domain {Baker's yeast (Saccharomyces cerevisiae)}
egssiesaskggyvlqdvanpdiilvatgsevslsveaaktlaaknikarvvslpdfftf
dkqpleyrlsvlpdnvpimsvevlattcwgkyahqsfgidrfgasgkapevfkffgftpe
gvaeraqktiafykgdklisplkkaf
Timeline for d1gpua3: