Lineage for d1gpua3 (1gpu A:535-680)

  1. Root: SCOP 1.63
  2. 235644Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 245392Fold c.48: TK C-terminal domain-like [52921] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 13245, strand 1 is antiparallel to the rest
  4. 245393Superfamily c.48.1: TK C-terminal domain-like [52922] (3 families) (S)
  5. 245394Family c.48.1.1: Transketolase C-terminal domain-like [52923] (2 proteins)
  6. 245399Protein Transketolase (TK), C-domain [52924] (2 species)
    two N-terminal domains are PP and Pyr modules of thiamin-binding fold
  7. 245400Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [52925] (7 PDB entries)
  8. 245401Domain d1gpua3: 1gpu A:535-680 [65456]
    Other proteins in same PDB: d1gpua1, d1gpua2, d1gpub1, d1gpub2

Details for d1gpua3

PDB Entry: 1gpu (more details), 1.86 Å

PDB Description: transketolase complex with reaction intermediate

SCOP Domain Sequences for d1gpua3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gpua3 c.48.1.1 (A:535-680) Transketolase (TK), C-domain {Baker's yeast (Saccharomyces cerevisiae)}
egssiesaskggyvlqdvanpdiilvatgsevslsveaaktlaaknikarvvslpdfftf
dkqpleyrlsvlpdnvpimsvevlattcwgkyahqsfgidrfgasgkapevfkffgftpe
gvaeraqktiafykgdklisplkkaf

SCOP Domain Coordinates for d1gpua3:

Click to download the PDB-style file with coordinates for d1gpua3.
(The format of our PDB-style files is described here.)

Timeline for d1gpua3: