Lineage for d1gpua2 (1gpu A:338-534)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 179051Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
  4. 179052Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (4 families) (S)
  5. 179098Family c.36.1.2: TK-like [52528] (2 proteins)
  6. 179105Protein Transketolase, TK [52529] (1 species)
  7. 179106Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [52530] (7 PDB entries)
  8. 179108Domain d1gpua2: 1gpu A:338-534 [65455]
    Other proteins in same PDB: d1gpua3, d1gpub3

Details for d1gpua2

PDB Entry: 1gpu (more details), 1.86 Å

PDB Description: transketolase complex with reaction intermediate

SCOP Domain Sequences for d1gpua2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gpua2 c.36.1.2 (A:338-534) Transketolase, TK {Baker's yeast (Saccharomyces cerevisiae)}
lpanwesklptytakdsavatrklsetvledvynqlpeliggsadltpsnltrwkealdf
qppssgsgnysgryirygirehamgaimngisafganykpyggtflnfvsyaagavrlsa
lsghpviwvathdsigvgedgpthqpietlahfrslpniqvwrpadgnevsaayknsles
khtpsiialsrqnlpql

SCOP Domain Coordinates for d1gpua2:

Click to download the PDB-style file with coordinates for d1gpua2.
(The format of our PDB-style files is described here.)

Timeline for d1gpua2: