Lineage for d1gpja3 (1gpj A:1-143)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2955589Superfamily d.58.39: Glutamyl tRNA-reductase catalytic, N-terminal domain [69742] (1 family) (S)
    common fold is elaborated with additional secondary structures
    automatically mapped to Pfam PF05201
  5. 2955590Family d.58.39.1: Glutamyl tRNA-reductase catalytic, N-terminal domain [69743] (1 protein)
  6. 2955591Protein Glutamyl tRNA-reductase catalytic, N-terminal domain [69744] (1 species)
  7. 2955592Species Methanopyrus kandleri [TaxId:2320] [69745] (1 PDB entry)
  8. 2955593Domain d1gpja3: 1gpj A:1-143 [65453]
    Other proteins in same PDB: d1gpja1, d1gpja2
    complexed with cit, glu, gmc

Details for d1gpja3

PDB Entry: 1gpj (more details), 1.95 Å

PDB Description: glutamyl-trna reductase from methanopyrus kandleri
PDB Compounds: (A:) glutamyl-tRNA reductase

SCOPe Domain Sequences for d1gpja3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gpja3 d.58.39.1 (A:1-143) Glutamyl tRNA-reductase catalytic, N-terminal domain {Methanopyrus kandleri [TaxId: 2320]}
medlvsvgithkeaeveelekarfesdeavrdivesfglsgsvllqtsnrvevyasgard
raeelgdlihddawvkrgseavrhlfrvasglesmmvgeqeilrqvkkaydraarlgtld
ealkivfrrainlgkrareetri

SCOPe Domain Coordinates for d1gpja3:

Click to download the PDB-style file with coordinates for d1gpja3.
(The format of our PDB-style files is described here.)

Timeline for d1gpja3: