Lineage for d1gpja1 (1gpj A:303-404)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1100577Fold a.151: Glutamyl tRNA-reductase dimerization domain [69074] (1 superfamily)
    6 helices, homodimer of 3-helical domains
  4. 1100578Superfamily a.151.1: Glutamyl tRNA-reductase dimerization domain [69075] (1 family) (S)
  5. 1100579Family a.151.1.1: Glutamyl tRNA-reductase dimerization domain [69076] (1 protein)
  6. 1100580Protein Glutamyl tRNA-reductase dimerization domain [69077] (1 species)
    includes the long 'spinal' helix
  7. 1100581Species Methanopyrus kandleri [TaxId:2320] [69078] (1 PDB entry)
  8. 1100582Domain d1gpja1: 1gpj A:303-404 [65451]
    Other proteins in same PDB: d1gpja2, d1gpja3
    complexed with cit, glu, gmc

Details for d1gpja1

PDB Entry: 1gpj (more details), 1.95 Å

PDB Description: glutamyl-trna reductase from methanopyrus kandleri
PDB Compounds: (A:) glutamyl-tRNA reductase

SCOPe Domain Sequences for d1gpja1:

Sequence, based on SEQRES records: (download)

>d1gpja1 a.151.1.1 (A:303-404) Glutamyl tRNA-reductase dimerization domain {Methanopyrus kandleri [TaxId: 2320]}
eipkveklieeelstveeeleklkerrlvadvakslheikdreleralrrlktgdpenvl
qdfaeaytkrlinvltsaimelpdeyrraasralrraselng

Sequence, based on observed residues (ATOM records): (download)

>d1gpja1 a.151.1.1 (A:303-404) Glutamyl tRNA-reductase dimerization domain {Methanopyrus kandleri [TaxId: 2320]}
eipkveklieeelstveeeleklkerrlvadvakslheikdreleralrrlktvlqdfae
aytkrlinvltsaimelpdeyrraasralrraselng

SCOPe Domain Coordinates for d1gpja1:

Click to download the PDB-style file with coordinates for d1gpja1.
(The format of our PDB-style files is described here.)

Timeline for d1gpja1: