SCOPe 2.03: Domain d1gp9d1: 1gp9 D:39-125

Lineage for d1gp9d1 (1gp9 D:39-125)

1. Root: SCOPe 2.03

2. Class g: Small proteins [56992] (90 folds)

3. Fold g.10: Hairpin loop containing domain-like [57413] (1 superfamily)
   alpha+beta fold with two crossing loops

4. Superfamily g.10.1: Hairpin loop containing domain-like [57414] (3 families)
   the middle part is structurally similar to some knottins and defensins but differs in the disulfide pattern

5. Family g.10.1.1: Hairpin loop containing domain [57415] (2 proteins)
   automatically mapped to Pfam PF00024

6. Protein Hepatocyte growth factor [57416] (1 species)
   heparin-binding domain

7. Species Human (Homo sapiens) [TaxId:9606] [57417] (9 PDB entries)

8. Domain d1gp9d1: 1gp9 D:39-125 [65448]
   Other proteins in same PDB: d1gp9a2, d1gp9b2, d1gp9c2, d1gp9d2
   complexed with epe

Details for d1gp9d1

PDB Entry: 1gp9, 2.5 Å

PDB Description: a new crystal form of the nk1 splice variant of hgf/sf demonstrates extensive hinge movement and suggests that the nk1 dimer originates by domain swapping

PDB Compounds: (D:) hepatocyte growth factor

SCOPe Domain Sequences for d1gp9d1:

Sequence; same for both SEQRES and ATOM records:

>d1gp9d1 g.10.1.1 (D:39-125) Hepatocyte growth factor {Human (Homo sapiens) [TaxId: 9606]}
vhefkksakttlikidpalkiktkkvntadqcanrctrnkglpftckafvfdkarkqclw
fpfnsmssgvkkefghefdlyenkdyi

Timeline for d1gp9d1:

• d1gp9d1 first appeared in SCOP 1.59
  
• d1gp9d1 appears in SCOPe 2.02
  
• d1gp9d1 appears in SCOPe 2.04
  
• d1gp9d1 appears in the current release, SCOPe 2.08