SCOP 1.73: Domain d1gp5a_: 1gp5 A:

Lineage for d1gp5a_ (1gp5 A:)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.2: Clavaminate synthase-like [51197] (12 families)
   Iron and ketoglutarate-dependent enzymes; elaborated version of this common fold

5. Family b.82.2.1: Penicillin synthase-like [51198] (4 proteins)
   common fold is rather distorted

6. Protein Anthocyanidin synthase [69346] (1 species)

7. Species Mouse-ear cress (Arabidopsis thaliana) [TaxId:3702] [69347] (4 PDB entries)

8. Domain d1gp5a_: 1gp5 A: [65440]
   complexed with 2og, dh2, dqh, fe, mes

Details for d1gp5a_

PDB Entry: 1gp5, 2.2 Å

PDB Description: Anthocyanidin synthase from Arabidopsis thaliana complexed with trans-dihydroquercetin

PDB Compounds: (A:) leucoanthocyanidin dioxygenase

SCOP Domain Sequences for d1gp5a_:

Sequence; same for both SEQRES and ATOM records:

>d1gp5a_ b.82.2.1 (A:) Anthocyanidin synthase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]}
vaverveslaksgiisipkeyirpkeelesindvfleekkedgpqvptidlkniesddek
irencieelkkasldwgvmhlinhgipadlmervkkageeffslsveekekyandqatgk
iqgygsklannasgqlewedyffhlaypeekrdlsiwpktpsdyieatseyakclrllat
kvfkalsvglglepdrlekevggleelllqmkinyypkcpqpelalgveahtdvsaltfi
lhnmvpglqlfyegkwvtakcvpdsivmhigdtleilsngkyksilhrglvnkekvrisw
avfceppkdkivlkplpemvsvespakfpprtfaqhiehklfgkeq

Timeline for d1gp5a_:

• d1gp5a_ first appeared in SCOP 1.59
  
• d1gp5a_ appears in SCOP 1.71
  
• d1gp5a_ appears in SCOP 1.75
  
• d1gp5a_ appears in the current release, SCOPe 2.08