![]() | Class b: All beta proteins [48724] (141 folds) |
![]() | Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
![]() | Superfamily b.82.2: Clavaminate synthase-like [51197] (8 families) ![]() Iron and ketoglutarate-dependent enzymes; elaborated version of this common fold |
![]() | Family b.82.2.1: Penicillin synthase-like [51198] (3 proteins) common fold is rather distorted |
![]() | Protein Anthocyanidin synthase [69346] (1 species) |
![]() | Species Mouse-ear cress (Arabidopsis thaliana) [TaxId:3702] [69347] (3 PDB entries) |
![]() | Domain d1gp5a_: 1gp5 A: [65440] complexed with 2og, dh2, dqh, fe, mes |
PDB Entry: 1gp5 (more details), 2.2 Å
SCOP Domain Sequences for d1gp5a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gp5a_ b.82.2.1 (A:) Anthocyanidin synthase {Mouse-ear cress (Arabidopsis thaliana)} vaverveslaksgiisipkeyirpkeelesindvfleekkedgpqvptidlkniesddek irencieelkkasldwgvmhlinhgipadlmervkkageeffslsveekekyandqatgk iqgygsklannasgqlewedyffhlaypeekrdlsiwpktpsdyieatseyakclrllat kvfkalsvglglepdrlekevggleelllqmkinyypkcpqpelalgveahtdvsaltfi lhnmvpglqlfyegkwvtakcvpdsivmhigdtleilsngkyksilhrglvnkekvrisw avfceppkdkivlkplpemvsvespakfpprtfaqhiehklfgkeq
Timeline for d1gp5a_: