Lineage for d1gp5a_ (1gp5 A:)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 381159Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 381367Superfamily b.82.2: Clavaminate synthase-like [51197] (8 families) (S)
    Iron and ketoglutarate-dependent enzymes; elaborated version of this common fold
  5. 381368Family b.82.2.1: Penicillin synthase-like [51198] (3 proteins)
    common fold is rather distorted
  6. 381369Protein Anthocyanidin synthase [69346] (1 species)
  7. 381370Species Mouse-ear cress (Arabidopsis thaliana) [TaxId:3702] [69347] (3 PDB entries)
  8. 381372Domain d1gp5a_: 1gp5 A: [65440]
    complexed with 2og, dh2, dqh, fe, mes

Details for d1gp5a_

PDB Entry: 1gp5 (more details), 2.2 Å

PDB Description: Anthocyanidin synthase from Arabidopsis thaliana complexed with trans-dihydroquercetin

SCOP Domain Sequences for d1gp5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gp5a_ b.82.2.1 (A:) Anthocyanidin synthase {Mouse-ear cress (Arabidopsis thaliana)}
vaverveslaksgiisipkeyirpkeelesindvfleekkedgpqvptidlkniesddek
irencieelkkasldwgvmhlinhgipadlmervkkageeffslsveekekyandqatgk
iqgygsklannasgqlewedyffhlaypeekrdlsiwpktpsdyieatseyakclrllat
kvfkalsvglglepdrlekevggleelllqmkinyypkcpqpelalgveahtdvsaltfi
lhnmvpglqlfyegkwvtakcvpdsivmhigdtleilsngkyksilhrglvnkekvrisw
avfceppkdkivlkplpemvsvespakfpprtfaqhiehklfgkeq

SCOP Domain Coordinates for d1gp5a_:

Click to download the PDB-style file with coordinates for d1gp5a_.
(The format of our PDB-style files is described here.)

Timeline for d1gp5a_: