SCOPe 2.05: Domain d1gp4a_: 1gp4 A:

Lineage for d1gp4a_ (1gp4 A:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.2: Clavaminate synthase-like [51197] (16 families)
   Iron and ketoglutarate-dependent enzymes; elaborated version of this common fold

5. Family b.82.2.1: Penicillin synthase-like [51198] (5 proteins)
   common fold is rather distorted

6. Protein Anthocyanidin synthase [69346] (1 species)

7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [69347] (3 PDB entries)

8. Domain d1gp4a_: 1gp4 A: [65439]
   complexed with akg, mes

Details for d1gp4a_

PDB Entry: 1gp4, 2.1 Å

PDB Description: Anthocyanidin synthase from Arabidopsis thaliana (selenomethionine substituted)

PDB Compounds: (A:) anthocyanidin synthase

SCOPe Domain Sequences for d1gp4a_:

Sequence; same for both SEQRES and ATOM records:

>d1gp4a_ b.82.2.1 (A:) Anthocyanidin synthase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
vaverveslaksgiisipkeyirpkeelesindvfleekkedgpqvptidlkniesddek
irencieelkkasldwgvmhlinhgipadlmervkkageeffslsveekekyandqatgk
iqgygsklannasgqlewedyffhlaypeekrdlsiwpktpsdyieatseyakclrllat
kvfkalsvglglepdrlekevggleelllqmkinyypkcpqpelalgveahtdvsaltfi
lhnmvpglqlfyegkwvtakcvpdsivmhigdtleilsngkyksilhrglvnkekvrisw
avfceppkdkivlkplpemvsvespakfpprtfaqhiehklfgkeqe

Timeline for d1gp4a_:

• d1gp4a_ first appeared in SCOP 1.59
  
• d1gp4a_ appears in SCOPe 2.04
  
• d1gp4a_ appears in SCOPe 2.06
  
• d1gp4a_ appears in the current release, SCOPe 2.08