SCOPe 2.06: Domain d1goya_: 1goy A:

Lineage for d1goya_ (1goy A:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.1: Microbial ribonucleases [53932] (1 superfamily)
   single helix packs against antiparallel beta-sheet

4. Superfamily d.1.1: Microbial ribonucleases [53933] (4 families)

5. Family d.1.1.2: Bacterial ribonucleases [81307] (6 proteins)

6. Protein Binase [81306] (1 species)

7. Species Bacillus intermedius [TaxId:1400] [53946] (5 PDB entries)

8. Domain d1goya_: 1goy A: [65433]
   complexed with 3gp, so4

Details for d1goya_

PDB Entry: 1goy, 2 Å

PDB Description: hydrolase(endoribonuclease)ribonuclease bi(g specific endonuclease) (e.c.3.1.27.-) complexed with guanosine-3'-phosphate (3'-gmp)

PDB Compounds: (A:) Ribonuclease

SCOPe Domain Sequences for d1goya_:

Sequence; same for both SEQRES and ATOM records:

>d1goya_ d.1.1.2 (A:) Binase {Bacillus intermedius [TaxId: 1400]}
vintfdgvadylirykrlpndyitksqasalgwvaskgdlaevapgksiggdvfsnregr
lpsagsrtwreadinyvsgfrnadrlvyssdwliykttdhyatftrir

Timeline for d1goya_:

• d1goya_ first appeared in SCOP 1.59
  
• d1goya_ appears in SCOPe 2.05
  
• d1goya_ appears in SCOPe 2.07
  
• d1goya_ appears in the current release, SCOPe 2.08