Lineage for d1govb_ (1gov B:)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 849710Fold d.1: Microbial ribonucleases [53932] (1 superfamily)
    single helix packs against antiparallel beta-sheet
  4. 849711Superfamily d.1.1: Microbial ribonucleases [53933] (3 families) (S)
  5. 849712Family d.1.1.2: Bacterial ribonucleases [81307] (5 proteins)
  6. 849834Protein Binase [81306] (1 species)
  7. 849835Species Bacillus intermedius [TaxId:1400] [53946] (5 PDB entries)
  8. 849839Domain d1govb_: 1gov B: [65432]
    complexed with so4

Details for d1govb_

PDB Entry: 1gov (more details), 2 Å

PDB Description: ribonuclease bi(g specific endonuclease) complexed with sulfate ions
PDB Compounds: (B:) Ribonuclease

SCOP Domain Sequences for d1govb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1govb_ d.1.1.2 (B:) Binase {Bacillus intermedius [TaxId: 1400]}
vintfdgvadylirykrlpndyitksqasalgwvaskgdlaevapgksiggdvfsnregr
lpsagsrtwreadinyvsgfrnadrlvyssdwliykttdhyatftrir

SCOP Domain Coordinates for d1govb_:

Click to download the PDB-style file with coordinates for d1govb_.
(The format of our PDB-style files is described here.)

Timeline for d1govb_: