Lineage for d1goub_ (1gou B:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1886642Fold d.1: Microbial ribonucleases [53932] (1 superfamily)
    single helix packs against antiparallel beta-sheet
  4. 1886643Superfamily d.1.1: Microbial ribonucleases [53933] (4 families) (S)
  5. 1886644Family d.1.1.2: Bacterial ribonucleases [81307] (6 proteins)
  6. 1886775Protein Binase [81306] (1 species)
  7. 1886776Species Bacillus intermedius [TaxId:1400] [53946] (5 PDB entries)
  8. 1886778Domain d1goub_: 1gou B: [65430]

Details for d1goub_

PDB Entry: 1gou (more details), 1.65 Å

PDB Description: ribonuclease binase (g specific endonuclease) unliganded form
PDB Compounds: (B:) Ribonuclease

SCOPe Domain Sequences for d1goub_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1goub_ d.1.1.2 (B:) Binase {Bacillus intermedius [TaxId: 1400]}
avintfdgvadylirykrlpndyitksqasalgwvaskgdlaevapgksiggdvfsnreg
rlpsagsrtwreadinyvsgfrnadrlvyssdwliykttdhyatftrir

SCOPe Domain Coordinates for d1goub_:

Click to download the PDB-style file with coordinates for d1goub_.
(The format of our PDB-style files is described here.)

Timeline for d1goub_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1goua_