Lineage for d1gosb2 (1gos B:290-401)

  1. Root: SCOP 1.61
  2. 187024Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
  3. 189842Fold d.16: FAD-linked reductases, C-terminal domain [54372] (1 superfamily)
  4. 189843Superfamily d.16.1: FAD-linked reductases, C-terminal domain [54373] (7 families) (S)
  5. 189959Family d.16.1.5: L-amino acid/polyamine oxidase [54394] (3 proteins)
  6. 189974Protein Monoamine oxidase B [69673] (1 species)
  7. 189975Species Human (Homo sapiens) [TaxId:9606] [69674] (1 PDB entry)
  8. 189977Domain d1gosb2: 1gos B:290-401 [65428]
    Other proteins in same PDB: d1gosa1, d1gosb1

Details for d1gosb2

PDB Entry: 1gos (more details), 3 Å

PDB Description: human monoamine oxidase b

SCOP Domain Sequences for d1gosb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gosb2 d.16.1.5 (B:290-401) Monoamine oxidase B {Human (Homo sapiens)}
plgsvikcivyykepfwrkkdycgtmiidgeeapvaytlddtkpegnyaaimgfilahka
rklarltkeerlkklcelyakvlgslealepvhyeeknwceeqysggcytty

SCOP Domain Coordinates for d1gosb2:

Click to download the PDB-style file with coordinates for d1gosb2.
(The format of our PDB-style files is described here.)

Timeline for d1gosb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1gosb1