Lineage for d1gosb1 (1gos B:4-289,B:402-496)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2849308Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
    core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander
  4. 2849309Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (9 families) (S)
  5. 2849379Family c.3.1.2: FAD-linked reductases, N-terminal domain [51913] (18 proteins)
    C-terminal domain is alpha+beta is common for the family
  6. 2849493Protein Monoamine oxidase B [69423] (2 species)
  7. 2849494Species Human (Homo sapiens) [TaxId:9606] [69424] (46 PDB entries)
  8. 2849584Domain d1gosb1: 1gos B:4-289,B:402-496 [65427]
    Other proteins in same PDB: d1gosa2, d1gosb2
    complexed with fad, nyp

Details for d1gosb1

PDB Entry: 1gos (more details), 3 Å

PDB Description: human monoamine oxidase b
PDB Compounds: (B:) monoamine oxidase

SCOPe Domain Sequences for d1gosb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gosb1 c.3.1.2 (B:4-289,B:402-496) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]}
kcdvvvvgggisgmaaakllhdsglnvvvleardrvggrtytlrnqkvkyvdlggsyvgp
tqnrilrlakelgletykvneverlihhvkgksypfrgpfppvwnpityldhnnfwrtmd
dmgreipsdapwkaplaeewdnmtmkelldklcwtesakqlatlfvnlcvtaethevsal
wflwyvkqcggttriisttnggqerkfvggsgqvserimdllgdrvklerpviyidqtre
nvlvetlnhemyeakyvisaipptlgmkihfnpplpmmrnqmitrvXfppgiltqygrvl
rqpvdriyfagtetathwsgymegaveageraareilhamgkipedeiwqsepesvdvpa
qpitttflerhlpsvpgllrli

SCOPe Domain Coordinates for d1gosb1:

Click to download the PDB-style file with coordinates for d1gosb1.
(The format of our PDB-style files is described here.)

Timeline for d1gosb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1gosb2