Lineage for d1gosa2 (1gos A:290-401)

  1. Root: SCOP 1.65
  2. 323018Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
  3. 326096Fold d.16: FAD-linked reductases, C-terminal domain [54372] (1 superfamily)
    alpha+beta sandwich
  4. 326097Superfamily d.16.1: FAD-linked reductases, C-terminal domain [54373] (6 families) (S)
    N-terminal domain is beta/beta/alpha common fold
  5. 326235Family d.16.1.5: L-aminoacid/polyamine oxidase [54394] (3 proteins)
  6. 326250Protein Monoamine oxidase B [69673] (1 species)
  7. 326251Species Human (Homo sapiens) [TaxId:9606] [69674] (1 PDB entry)
  8. 326252Domain d1gosa2: 1gos A:290-401 [65426]
    Other proteins in same PDB: d1gosa1, d1gosb1

Details for d1gosa2

PDB Entry: 1gos (more details), 3 Å

PDB Description: human monoamine oxidase b

SCOP Domain Sequences for d1gosa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gosa2 d.16.1.5 (A:290-401) Monoamine oxidase B {Human (Homo sapiens)}
plgsvikcivyykepfwrkkdycgtmiidgeeapvaytlddtkpegnyaaimgfilahka
rklarltkeerlkklcelyakvlgslealepvhyeeknwceeqysggcytty

SCOP Domain Coordinates for d1gosa2:

Click to download the PDB-style file with coordinates for d1gosa2.
(The format of our PDB-style files is described here.)

Timeline for d1gosa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1gosa1