Lineage for d1goqa_ (1goq A:)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 383642Fold c.1: TIM beta/alpha-barrel [51350] (28 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 384382Superfamily c.1.8: (Trans)glycosidases [51445] (10 families) (S)
  5. 384721Family c.1.8.3: beta-glycanases [51487] (22 proteins)
    consist of a number of sequence families
  6. 385002Protein Xylanase A, catalytic core [51514] (7 species)
  7. 385061Species Thermoascus aurantiacus [TaxId:5087] [51518] (9 PDB entries)
  8. 385068Domain d1goqa_: 1goq A: [65423]
    complexed with xyp

Details for d1goqa_

PDB Entry: 1goq (more details), 1.8 Å

PDB Description: thermostable xylanase i from thermoascus aurantiacus - room temperature xylobiose complex

SCOP Domain Sequences for d1goqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1goqa_ c.1.8.3 (A:) Xylanase A, catalytic core {Thermoascus aurantiacus}
eaaqsvdqlikargkvyfgvatdqnrlttgknaaiiqadfgqvtpensmkwdatepsqgn
fnfagadylvnwaqqngklirghtlvwhsqlpswvssitdkntltnvmknhittlmtryk
gkirawdvvneafnedgslrqtvflnvigedyipiafqtaraadpnaklyindynldsas
ypktqaivnrvkqwraagvpidgigsqthlsagqgagvlqalpllasagtpevaiteldv
agasptdyvnvvnaclnvqscvgitvwgvadpdswrasttpllfdgnfnpkpaynaivqd
lqq

SCOP Domain Coordinates for d1goqa_:

Click to download the PDB-style file with coordinates for d1goqa_.
(The format of our PDB-style files is described here.)

Timeline for d1goqa_: