SCOP 1.75: Domain d1goja_: 1goj A:

Lineage for d1goja_ (1goj A:)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (24 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.9: Motor proteins [52641] (4 proteins)

6. Protein Kinesin [52646] (7 species)

7. Species Neurospora crassa [TaxId:5141] [69490] (1 PDB entry)

8. Domain d1goja_: 1goj A: [65419]
   complexed with adp, mg

Details for d1goja_

PDB Entry: 1goj, 2.3 Å

PDB Description: structure of a fast kinesin: implications for atpase mechanism and interactions with microtubules

PDB Compounds: (A:) kinesin heavy chain

SCOP Domain Sequences for d1goja_:

Sequence; same for both SEQRES and ATOM records:

>d1goja_ c.37.1.9 (A:) Kinesin {Neurospora crassa [TaxId: 5141]}
sssansikvvarfrpqnrveiesggqpivtfqgpdtctvdskeaqgsftfdrvfdmsckq
sdifdfsikptvddilngyngtvfaygqtgagksytmmgtsiddpdgrgvipriveqift
silssaanieytvrvsymeiymerirdllapqndnlpvheeknrgvyvkglleiyvssvq
evyevmrrggnaravaatnmnqessrshsifvititqknvetgsaksgqlflvdlagsek
vgktgasgqtleeakkinkslsalgmvinaltdgksshvpyrdskltrilqeslggnsrt
tliincspssyndaetlstlrfgmraksiknkakvnaelspaelkqmlakaktq

Timeline for d1goja_:

• d1goja_ first appeared in SCOP 1.59
  
• d1goja_ appears in SCOP 1.73
  
• d1goja_ appears in SCOPe 2.01
  
• d1goja_ appears in the current release, SCOPe 2.08