Lineage for d1goja_ (1goj A:)

  1. Root: SCOP 1.63
  2. 235644Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 242911Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 242912Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (20 families) (S)
    division into families based on beta-sheet topologies
  5. 243546Family c.37.1.9: Motor proteins [52641] (3 proteins)
  6. 243547Protein Kinesin [52646] (5 species)
  7. 243557Species Neurospora crassa [TaxId:5141] [69490] (1 PDB entry)
  8. 243558Domain d1goja_: 1goj A: [65419]
    complexed with adp, mg

Details for d1goja_

PDB Entry: 1goj (more details), 2.3 Å

PDB Description: structure of a fast kinesin: implications for atpase mechanism and interactions with microtubules

SCOP Domain Sequences for d1goja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1goja_ c.37.1.9 (A:) Kinesin {Neurospora crassa}
sssansikvvarfrpqnrveiesggqpivtfqgpdtctvdskeaqgsftfdrvfdmsckq
sdifdfsikptvddilngyngtvfaygqtgagksytmmgtsiddpdgrgvipriveqift
silssaanieytvrvsymeiymerirdllapqndnlpvheeknrgvyvkglleiyvssvq
evyevmrrggnaravaatnmnqessrshsifvititqknvetgsaksgqlflvdlagsek
vgktgasgqtleeakkinkslsalgmvinaltdgksshvpyrdskltrilqeslggnsrt
tliincspssyndaetlstlrfgmraksiknkakvnaelspaelkqmlakaktq

SCOP Domain Coordinates for d1goja_:

Click to download the PDB-style file with coordinates for d1goja_.
(The format of our PDB-style files is described here.)

Timeline for d1goja_: