Lineage for d1goja_ (1goj A:)
- Root: SCOP 1.59
Class c: Alpha and beta proteins (a/b) [51349] (113 folds) 
Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily) Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (16 families) 
Family c.37.1.9: Motor proteins [52641] (3 proteins) 
Protein Kinesin [52646] (5 species) 
Species Neurospora crassa [TaxId:5141] [69490] (1 PDB entry) 
Domain d1goja_: 1goj A: [65419]
Details for d1goja_
PDB Entry: 1goj (more details), 2.3 Å
PDB Description: structure of a fast kinesin: implications for atpase mechanism and interactions with microtubules
SCOP Domain Sequences for d1goja_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1goja_ c.37.1.9 (A:) Kinesin {Neurospora crassa}
sssansikvvarfrpqnrveiesggqpivtfqgpdtctvdskeaqgsftfdrvfdmsckq
sdifdfsikptvddilngyngtvfaygqtgagksytmmgtsiddpdgrgvipriveqift
silssaanieytvrvsymeiymerirdllapqndnlpvheeknrgvyvkglleiyvssvq
evyevmrrggnaravaatnmnqessrshsifvititqknvetgsaksgqlflvdlagsek
vgktgasgqtleeakkinkslsalgmvinaltdgksshvpyrdskltrilqeslggnsrt
tliincspssyndaetlstlrfgmraksiknkakvnaelspaelkqmlakaktq
SCOP Domain Coordinates for d1goja_:
Click to download the PDB-style file with coordinates for d1goja_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1goja_:
- d1goja_ is new in SCOP 1.59
- d1goja_ appears in SCOP 1.61
- d1goja_ appears in the current release, SCOPe 2.08
View in 3D