Lineage for d1goib3 (1goi B:292-379)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 501849Fold d.26: FKBP-like [54533] (3 superfamilies)
    core: beta(2)-alpha-beta(2); antiparallel beta-sheet
  4. 502014Superfamily d.26.3: Chitinase insertion domain [54556] (1 family) (S)
  5. 502015Family d.26.3.1: Chitinase insertion domain [54557] (10 proteins)
  6. 502042Protein Chitinase B [54560] (1 species)
  7. 502043Species Serratia marcescens [TaxId:615] [54561] (14 PDB entries)
  8. 502045Domain d1goib3: 1goi B:292-379 [65418]
    Other proteins in same PDB: d1goia1, d1goia2, d1goib1, d1goib2

Details for d1goib3

PDB Entry: 1goi (more details), 1.45 Å

PDB Description: crystal structure of the d140n mutant of chitinase b from serratia marcescens at 1.45 a resolution

SCOP Domain Sequences for d1goib3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1goib3 d.26.3.1 (B:292-379) Chitinase B {Serratia marcescens}
ygrafkgvsggnggqysshstpgedpypstdywlvgceecvrdkdpriasyrqleqmlqg
nygyqrlwndktktpylyhaqnglfvty

SCOP Domain Coordinates for d1goib3:

Click to download the PDB-style file with coordinates for d1goib3.
(The format of our PDB-style files is described here.)

Timeline for d1goib3: