Lineage for d1goib2 (1goi B:3-291,B:380-446)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1815292Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1818156Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 1819776Family c.1.8.5: Type II chitinase [51534] (15 proteins)
    glycosylase family 18
  6. 1819835Protein Chitinase B, catalytic domain [51546] (1 species)
  7. 1819836Species Serratia marcescens [TaxId:615] [51547] (18 PDB entries)
  8. 1819838Domain d1goib2: 1goi B:3-291,B:380-446 [65417]
    Other proteins in same PDB: d1goia1, d1goia3, d1goib1, d1goib3
    complexed with gol, so4; mutant

Details for d1goib2

PDB Entry: 1goi (more details), 1.45 Å

PDB Description: crystal structure of the d140n mutant of chitinase b from serratia marcescens at 1.45 a resolution
PDB Compounds: (B:) chitinase b

SCOPe Domain Sequences for d1goib2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1goib2 c.1.8.5 (B:3-291,B:380-446) Chitinase B, catalytic domain {Serratia marcescens [TaxId: 615]}
trkavigyyfiptnqinnytetdtsvvpfpvsnitpakakqlthinfsfldinsnlecaw
dpatndakardvvnrltalkahnpslrimfsiggwyysndlgvshanyvnavktpasrak
faqscvrimkdygfdgvnidweypqaaevdgfiaalqeirtllnqqtitdgrqalpyqlt
iagaggafflsryysklaqivapldyinlmtydlagpwekvtnhqaalfgdaagptfyna
lreanlgwsweeltrafpspfsltvdaavqqhlmmegvpsakivmgvpfXddaesfkyka
kyikqqqlggvmfwhlgqdnrngdllaaldryfnaadyddsqldmgtglrytgvgpg

SCOPe Domain Coordinates for d1goib2:

Click to download the PDB-style file with coordinates for d1goib2.
(The format of our PDB-style files is described here.)

Timeline for d1goib2: